Genome Property Definition Page

Nameradical SAM/SPASM system Clo7bot
DescriptionThis property features a radical SAM/SPASM domain peptide maturase that, in multiple strains of Clostridium botulinum, is next to a tandem array of seven target peptides, all Cys-rich. This system also occurs in Clostridium sporogenes, and an array of six peptides occurs in Thermoanaerobacter italicus Ab9. Clostridium cellulovorans 743B has a matching radical SAM maturase, but a single weak candidate target sequence, MKFVKAPTKNISIIKCPYFCNTFFPILPPTF.
Parent PropertyGenProp0077: natural products biosynthesis
GenProp0077: natural products biosynthesis
GenProp0077: natural products biosynthesis

Step NameStep NumRequiredEvidence (Method)Evidence Go Terms
Clo7bot tandem target peptidemultiYESTIGR04333 (HMM): Cys-rich peptide, Clo7bot family
Clo7bot tandem target peptidemultiYESTIGR04333 (HMM): Cys-rich peptide, Clo7bot family
Clo7bot tandem target peptidemultiYESTIGR04333 (HMM): Cys-rich peptide, Clo7bot family
radical SAM/SPASM domain Clo7bot peptide maturaserSAM7YESTIGR04334 (HMM): radical SAM/SPASM domain Clo7bot peptide maturase
radical SAM/SPASM domain Clo7bot peptide maturaserSAM7YESTIGR04334 (HMM): radical SAM/SPASM domain Clo7bot peptide maturase
radical SAM/SPASM domain Clo7bot peptide maturaserSAM7YESTIGR04334 (HMM): radical SAM/SPASM domain Clo7bot peptide maturase

Parent Properties
GenProp0077natural products biosynthesis
GenProp0077natural products biosynthesis
GenProp0077natural products biosynthesis

Sibling Properties
GenProp0014polyketide biosynthesis, type I
GenProp0015polyketide biosynthesis, type II
GenProp0040thiotemplate type non-ribosomal peptide biosynthesis
GenProp0169hybrid NRPS-PKS natural pruduct biosynthesis genes
GenProp0724phosphonoacetaldehyde biosynthesis from phosphoenolpyruvate
GenProp0757quorum-sensing, autoinducer-2 system
GenProp0758lycopene biosynthesis from IPP
GenProp0770siderophore biosynthesis
GenProp0807bacteriocin system, heterocycle biosynthesis group
GenProp0808bacteriocin system, TIGR01847 leader group
GenProp0809bacteriocin system, lactococcin 972 group
GenProp0823violacein biosynthesis
GenProp0825bacteriocin system, circular bacteriocin group
GenProp0853lantibiotic system, gallidermin/epidermin family
GenProp0861bacteriocin system, NHLP (nif11/nitrile hydratase leader peptide) transport group
GenProp0901post-ribosomal natural product synthesis system, Burkholderia TOMM-type
GenProp0919SCIFF/radical SAM Clostridial gene pair
GenProp0920radical SAM Y_X(10)_GDL system
GenProp0921radical SAM pair and His-Xaa-Ser repeats peptide
GenProp0936bacteriocin system, sporulation delay protein group
GenProp0945radical SAM maturase bacteriocin system, CLI_3235 type
GenProp0954radical SAM-cylized peptide, Pep1357C family
GenProp0955modified peptide/radical SAM maturase system, YydFG family
GenProp0956radical SAM maturase/selenobacteriocin system
GenProp0962methanobactin biosynthesis, Mb-OB3b family
GenProp0967radical SAM maturase system, CXXX repeats type
GenProp0982radical SAM maturase system, FibroRumin system
GenProp0984radical SAM maturase system, GG-Bacteroidales group
GenProp0990cobaltopeptin biosynthesis
GenProp0991ATP-grasp maturase system, microviridin/marinostatin class
GenProp1000ATP-grasp maturase system, uncharacterized
GenProp1002grasp-with-spasm peptide maturase system
GenProp1003cysteine S-glycopeptide biosynthesis, sublancin family
GenProp1029radical SAM/SPASM system SynChlorMet
GenProp1037radical SAM/SPASM system GRRM
GenProp1052geopeptide radical SAM/SPASM maturase system
GenProp1065radical SAM/SPASM TIGR04347/TIGR04031 system
GenProp1078sporulation killing factor system
GenProp1083cyanobactin-like ribosomal natural product biosynthesis
GenProp1084enduracididine biosynthesis
GenProp1090radical SAM/SPASM maturase system XYE
GenProp1097bacimethrin biosynthesis
GenProp10983-methylarginine biosynthesis